PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_7183519F8.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 281aa    MW: 30974.2 Da    PI: 11.43
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_7183519F8.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-1799146148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg+WT+eEd++lv  ++ +G  +W++ ++  g+ R++k+c++rw +yl
  Traes_2DL_7183519F8.1  99 RGPWTPEEDKILVAHIHSHGHSNWRALPKQAGLLRCGKSCRLRWINYL 146
                            89******************************99************97 PP

2Myb_DNA-binding52.88.9e-17152197148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Traes_2DL_7183519F8.1 152 RGNFTDEEEQSIIQLHQLLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 197
                            89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-2590149IPR009057Homeodomain-like
PROSITE profilePS5129415.81694146IPR017930Myb domain
SuperFamilySSF466896.6E-3095193IPR009057Homeodomain-like
SMARTSM007171.7E-1398148IPR001005SANT/Myb domain
PfamPF002491.9E-1599146IPR001005SANT/Myb domain
CDDcd001671.52E-10101146No hitNo description
PROSITE profilePS5129425.243147201IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-26150201IPR009057Homeodomain-like
SMARTSM007171.7E-14151199IPR001005SANT/Myb domain
PfamPF002491.3E-15152197IPR001005SANT/Myb domain
CDDcd001672.10E-10154197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
WLLRRSCRIG PLKNVSAKRP HAGHKYPGHP RDSAITPRHQ AGRLAVLPPI SSLLSSPPKS  60
QRHREREDSS ASASAHTNSR GRGAIMGRAP CCEKMGLKRG PWTPEEDKIL VAHIHSHGHS  120
NWRALPKQAG LLRCGKSCRL RWINYLRPDI KRGNFTDEEE QSIIQLHQLL GNRWSAIAAR  180
LPGRTDNEIK NVWHTHLKKR LDPSAQEQHQ EAKKRKKPAA AARKREGKVK MRKLDALTAK  240
AAPVLSSPER SVSSTLTEST STASAAAEQH GNSGSSASAS A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27972025109B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197216KKRLDPSAQEQHQEAKKRKK
2212216KKRKK
3215232KKPAAAARKREGKVKMRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2521470.0AB252147.1 Triticum aestivum Tamyb7 mRNA for myb-related protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580139.11e-97PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH42e-82MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLW5BVY90.0W5BVY9_WHEAT; Uncharacterized protein
STRINGBRADI5G15760.15e-97(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-77myb domain protein 15
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]